POU3F2/OCT7 Antibody (CL6232)

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-61437

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-61437
NBP2-61437-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # CL6232

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all POU3F2 Antibodies »

Product Summary for POU3F2/OCT7 Antibody (CL6232)

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Scientific Data Images for POU3F2/OCT7 Antibody (CL6232)

Immunocytochemistry/ Immunofluorescence: POU3F2/OCT7 Antibody (CL6232) [NBP2-61437]

Immunocytochemistry/ Immunofluorescence: POU3F2/OCT7 Antibody (CL6232) [NBP2-61437]

Immunocytochemistry/Immunofluorescence: POU3F2/OCT7 Antibody (CL6232) [NBP2-61437] - Staining of U-251 cells using the Anti-POU3F2 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.
Immunohistochemistry-Paraffin: POU3F2/OCT7 Antibody (CL6232) [NBP2-61437]

Immunohistochemistry-Paraffin: POU3F2/OCT7 Antibody (CL6232) [NBP2-61437]

Immunohistochemistry-Paraffin: POU3F2/OCT7 Antibody (CL6232) [NBP2-61437] - Staining of rat cerebral cortex shows absence of positivity in layer 6 neurons as expected.
Immunohistochemistry-Paraffin: POU3F2/OCT7 Antibody (CL6232) [NBP2-61437]

Immunohistochemistry-Paraffin: POU3F2/OCT7 Antibody (CL6232) [NBP2-61437]

Immunohistochemistry-Paraffin: POU3F2/OCT7 Antibody (CL6232) [NBP2-61437] - Staining of mouse forebrain shows nuclear immunoreactivity in layers 2-5 of cerebral cortex.
View 3 more images

Applications for POU3F2/OCT7 Antibody (CL6232)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

2-10 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POU3F2

POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).[supplied by OMIM]

Long Name

POU Class 3 Homeobox 2

Alternate Names

Brain-2, BRN2, Oct7, OTF7

Gene Symbol

POU3F2

Additional POU3F2 Products

Product Documents for POU3F2/OCT7 Antibody (CL6232)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for POU3F2/OCT7 Antibody (CL6232)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.