PP1 Inhibitor-2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79889

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79889
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all PP1 Inhibitor-2 Antibodies »

Product Summary for PP1 Inhibitor-2 Antibody

Immunogen

The specific Immunogen is proprietary information. Peptide sequence ASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PP1 Inhibitor-2 Antibody

Western Blot: PP1 Inhibitor-2 Antibody [NBP1-79889]

Western Blot: PP1 Inhibitor-2 Antibody [NBP1-79889]

Western Blot: PP1 Inhibitor-2 Antibody [NBP1-79889] - Titration: 1.0 ug/ml Positive Control: THP-1 Whole Cell.

Applications for PP1 Inhibitor-2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PP1 Inhibitor-2

Two inhibitors of protein phosphatase 1 (PP1) include the phosphatase inhibitor 1 (IPP-1) and phosphatase inhibitor 2 (IPP-2). IPP-2, also known as I-2, interacts with the catalytic subunit of PP1 to form the heterodimer PP1I. The PP1I complex is present in the cytosol of cells in a broad range of vertebrate and invertebrate species. Although the heterodimer itself is inactive, a reversible phosphorylation of IPP-2 at Thr 72 by glycogen-synthase-kinase (GSK3) initiates activation of the heterodimer complex in vitro. Phosphorylation of IPP-2 by casein kinase-II at Ser 86, Ser 120, and Ser 121 enhances the rate of phosphorylation by GSK3 at Thr 72 and effectively activates the heterodimer complex. Besides moderating PP1 activity, IPP-2 may play a role as a chaperone for the correct folding of PP1. The gene for human IPP-2 maps to chromosome 6 in the major histocompatiblity complex region.

Long Name

Protein Phosphatase 1 Inhibitor 2

Alternate Names

IPP2, PP1 Inhibitor2, PPP1R2

Gene Symbol

PPP1R2

UniProt

NP_006232 (Human)

Additional PP1 Inhibitor-2 Products

Product Documents for PP1 Inhibitor-2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PP1 Inhibitor-2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.