PPAR alpha/NR1C1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57777

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-57777
NBP2-57777-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all PPAR alpha/NR1C1 Antibodies »

Product Summary for PPAR alpha/NR1C1 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTE

Reactivity Notes

Mouse 87%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PPAR alpha/NR1C1 Antibody

Western Blot: PPAR alpha/NR1C1 Antibody [NBP2-57777]

Western Blot: PPAR alpha/NR1C1 Antibody [NBP2-57777]

Western Blot: PPAR alpha/NR1C1 Antibody [NBP2-57777] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: PPAR alpha/NR1C1 Antibody [NBP2-57777]

Immunocytochemistry/ Immunofluorescence: PPAR alpha/NR1C1 Antibody [NBP2-57777]

Immunocytochemistry/Immunofluorescence: PPAR alpha/NR1C1 Antibody [NBP2-57777] - Staining of human cell line U-2 OS shows localization to nucleus.

Applications for PPAR alpha/NR1C1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPAR alpha/NR1C1

Peroxisome proliferators are non-genotoxic carcinogens which are purported to exert their effect on cells through their interaction with members of the nuclear hormone receptor family, termed peroxisome proliferator activated receptors (PPARs). Nuclear hormone receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate ligand. Studies indicate that PPARs are activated by peroxisome proliferators such as clofibric acid, nafenopin, and WY-14,643, as well as by some fatty acids. It has also been shown that PPARs can induce transcription of acyl coenzyme A oxidase & cytochrome P450 A6 (CYP450 A6) through interaction with specific response elements. PPAR alpha is activated by free fatty acids including linoleic, arachidonic, and oleic acids. Induction of peroxisomes by this mechanism leads to a reduction in blood triglyceride levels. PPAR alpha is expressed mainly in skeletal muscle, heart, liver, and kidney and is thought to regulate many genes involved in the beta-oxidation of fatty acids. Activation of rat liver PPAR alpha has been shown to suppress hepatocyte apoptosis. PPAR alpha, like several other nuclear hormone receptors, heterodimerizes with retinoic X receptor (RXR) alpha to form a transcriptionally competent complex. The corresponding gene for the PPAR alpha is NR1C1.

Long Name

Peroxisome Proliferator-activated Receptor alpha

Alternate Names

NR1C1, PPARA

Gene Symbol

PPARA

Additional PPAR alpha/NR1C1 Products

Product Documents for PPAR alpha/NR1C1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PPAR alpha/NR1C1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.