Prominin 2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38032

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38032-25ul
NBP2-38032
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Prominin 2 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ELGADFSQVPSVDHVLHQLKGVPEANFSSMVQEENSTFNALPALAAMQTSSVVQELKKAVAQQPEGVRTLAEGFP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Prominin 2 Antibody

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032]

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032]

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Analysis in human skin and liver tissues using NBP2-38032 antibody. Corresponding Prominin 2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Prominin 2 Antibody [NBP2-38032]

Immunocytochemistry/ Immunofluorescence: Prominin 2 Antibody [NBP2-38032]

Immunocytochemistry/Immunofluorescence: Prominin 2 Antibody [NBP2-38032] - Staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032]

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032]

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.
View 3 more images

Applications for Prominin 2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Prominin 2

Prominin 2 is a large-scale effort, termed the Secreted Protein Discovery Initiative (SPDI), was undertaken to identify novel secreted and transmembrane proteins. Several criteria were applied to identify and characterize these new and novel genes. First, a biological signal sequence trap in yeast cells was utilized to identify cDNA clones encoding putative secreted proteins, second strategy utilized various algorithms that recognize features such as the hydrophobic properties of signal sequences to identify putative proteins encoded by expressed sequence tags (ESTs) from human cDNA libraries and finally, ESTs for protein sequence similarity to a set of known receptors and their ligands with the BLAST algorithm. Based on these criteria isolation of full length cDNA clones for each of these genes resulted in identification of more than 1000 novel proteins. One of these new genes is Prominin2. Prominin 2 is a 112 kDa glycoporotein structurally related to Prominin 1 (CD133) although amino acid similarity is not more than 30% but their genomic organization is strikingly similar (1). Like Prominin1, the prominin 2 exhibit similar membrane topology with 5 trans-membrane domains and two large glycosylated extracellular domains. Similar to Prominin1 localization, the Prominin 2 is also associated with membrane protrusions of the epithelial cells from adult kidney, and all along the digestive track and other epithelial tissues. One striking difference between Prominin1 and Prominin 2 expression lies in its conspicuous absence in eye tissue (2). Prominin 2, along with other genes (AP1M2, MAL2, PRSS8 and FLJ20171) expression is differentially expressed in chromophobe renal cell carcinoma compared to benign oncocytoma consistently and this marker can be used to differentiate RCC form benign oncocytoma (3). Prominin 2 is an androgen-responsive genes proapoptotic membrane protein that is expressed in human prostate and human prostate cancer cell lines with highest levels in less aggressive LNCaP cell and low expression in highly aggressive PC3 and DU145 cells suggesting a role of Prominin 2 in down-regulation of aggressiveness of prostate cancer cells (4).

Alternate Names

PROM2, PROML2

Gene Symbol

PROM2

UniProt

Q8N271 (Human)

Additional Prominin 2 Products

Product Documents for Prominin 2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Prominin 2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.