Proteasome 20S alpha 3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54374

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54374
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Proteasome 20S alpha 3 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PSMA3(proteasome (prosome, macropain) subunit, alpha type, 3) The peptide sequence was selected from the middle region of PSMA3. Peptide sequence VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha type-3.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Proteasome 20S alpha 3 Antibody

Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-54374]

Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-54374]

Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-54374] - Human 721_B, Antibody Dilution: 1.0 ug/ml PSMA3 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-54374]

Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-54374]

Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-54374] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-54374]

Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-54374]

Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-54374] - Titration: 2 ug/ml Positive Control: Human NT-2 cells and Mouse WT brain.
View 1 more images

Applications for Proteasome 20S alpha 3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome 20S alpha 3

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

Long Name

Proteasome subunit alpha type-3

Alternate Names

HC8, PSC8, PSMA3

Gene Symbol

PSMA3

UniProt

P25788-2 (Human)

Additional Proteasome 20S alpha 3 Products

Product Documents for Proteasome 20S alpha 3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Proteasome 20S alpha 3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.