Protocadherin 21 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-92296

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-92296
NBP1-92296-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Frozen, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Protocadherin 21 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSGAISITQSPAQLQREVYELHVQVTE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%). Reactivity reported in the rat olfactory bulb from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Protocadherin 21 Antibody

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Frozen: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Frozen: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Frozen: Protocadherin 21 Antibody [NBP1-92296] - Strong protocadherin 21 (Pcdh21) labelling of mitral and tufted cells in the rat olfactory bulb (PND 15). Perfusion with 4% PFA, 30 um Cryocut brain slices. Image submitted by a verified customer review
Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human eye, retina shows moderate cytoplasmic and membranous positivity in cells in photoreceptor layer.
View 2 more images

Applications for Protocadherin 21 Antibody

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Frozen

Validated from a verified customer review.

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 4 using NBP1-92296 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protocadherin 21

Protocadherin 21 is a member of the cadherin superfamily of calcium-dependent cell-cell adhesion molecules. The encoded protein has a signal peptide, six cadherin repeat domains and a unique cytoplasmic region. This non-classical cadherin appears to be exclusively expressed in the mitral and tufted cells in the main and accessory olfactory bulbs of the brain, suggesting a possible role in the formation and maintenance of neuronal networks. [provided by RefSeq]

Alternate Names

cadherin-related family member 1, CORD15, KIAA1775DKFZp434A132, PCDH21MT-protocadherin, Photoreceptor cadherin, prCAD, PRCADprotocadherin-21, protocadherin 21, Protocadherin-21

Gene Symbol

CDHR1

Additional Protocadherin 21 Products

Product Documents for Protocadherin 21 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Protocadherin 21 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.