PSMF1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79738

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79738
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all PSMF1 Antibodies »

Product Summary for PSMF1 Antibody

Immunogen

Synthetic peptide directed towards the middle region of human PSMF1The immunogen for this antibody is PSMF1. Peptide sequence DYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PSMF1 Antibody

Western Blot: PSMF1 Antibody [NBP1-79738]

Western Blot: PSMF1 Antibody [NBP1-79738]

Western Blot: PSMF1 Antibody [NBP1-79738] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Applications for PSMF1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMF1

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene.

Alternate Names

hPI31, PI31, proteasome (prosome, macropain) inhibitor subunit 1 (PI31), proteasome inhibitor hP131 subunit, proteasome inhibitor PI31 subunit

Gene Symbol

PSMF1

UniProt

NP_006805 (Human)

Additional PSMF1 Products

Product Documents for PSMF1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PSMF1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.