PSMF1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-80910

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-80910
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all PSMF1 Antibodies »

Product Summary for PSMF1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSMF1 Antibody

Western Blot: PSMF1 Antibody [NBP1-80910]

Western Blot: PSMF1 Antibody [NBP1-80910]

Western Blot: PSMF1 Antibody [NBP1-80910] - Analysis in control (vector only transfected HEK293T lysate) and PSMF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: PSMF1 Antibody [NBP1-80910]

Immunocytochemistry/ Immunofluorescence: PSMF1 Antibody [NBP1-80910]

Immunocytochemistry/Immunofluorescence: PSMF1 Antibody [NBP1-80910] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: PSMF1 Antibody [NBP1-80910]

Immunohistochemistry-Paraffin: PSMF1 Antibody [NBP1-80910]

Immunohistochemistry-Paraffin: PSMF1 Antibody [NBP1-80910] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Applications for PSMF1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMF1

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene.

Alternate Names

hPI31, PI31, proteasome (prosome, macropain) inhibitor subunit 1 (PI31), proteasome inhibitor hP131 subunit, proteasome inhibitor PI31 subunit

Entrez Gene IDs

9491 (Human)

Gene Symbol

PSMF1

UniProt

Q92530 (Human)

Additional PSMF1 Products

Product Documents for PSMF1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PSMF1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.