PTBP1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57123

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-57123
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all PTBP1 Antibodies »

Product Summary for PTBP1 Antibody

Immunogen

Synthetic peptides corresponding to PTBP1(polypyrimidine tract binding protein 1) The peptide sequence was selected from the N terminal of PTBP1. Peptide sequence RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PTBP1 Antibody

Western Blot: PTBP1 Antibody [NBP1-57123]

Western Blot: PTBP1 Antibody [NBP1-57123]

Western Blot: PTBP1 Antibody [NBP1-57123] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml
Western Blot: PTBP1 Antibody [NBP1-57123]

Western Blot: PTBP1 Antibody [NBP1-57123]

Western Blot: PTBP1 Antibody [NBP1-57123] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Daudi cell lysate PTBP1 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells

Applications for PTBP1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTBP1

PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

Heterogeneous nuclear ribonucleoprotein I, heterogeneous nuclear ribonucleoprotein polypeptide I, hnRNP I, HNRNPI, HNRNP-I, HNRPI, MGC10830, MGC8461, polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoproteinI), polypyrimidine tract binding protein 1, polypyrimidine tract-binding protein 1, pPTB, PTB-1, PTB2, PTB3, PTB4, PTB57 kDa RNA-binding protein PPTB-1, PTB-T, RNA-binding protein

Gene Symbol

PTBP1

UniProt

P26599 (Human)

Additional PTBP1 Products

Product Documents for PTBP1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PTBP1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.