PUM1 Antibody (8Y6H5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15279

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15279-100ul
NBP3-15279-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8Y6H5

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all PUM1 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 104-203 of human PUM1 (Q14671). NNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PUM1 Antibody (8Y6H5)

Western Blot: PUM1 Antibody (8Y6H5) [NBP3-15279]

Western Blot: PUM1 Antibody (8Y6H5) [NBP3-15279]

Western Blot: PUM1 Antibody (8Y6H5) [NBP3-15279] - Western blot analysis of extracts of various cell lines, using PUM1 Rabbit mAb (NBP3-15279) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: PUM1 Antibody (8Y6H5) [NBP3-15279]

Immunocytochemistry/ Immunofluorescence: PUM1 Antibody (8Y6H5) [NBP3-15279]

Immunocytochemistry/Immunofluorescence: PUM1 Antibody (8Y6H5) [NBP3-15279] - Immunofluorescence analysis of U-2 OS cells using PUM1 Rabbit mAb (NBP3-15279) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for PUM1 Antibody (8Y6H5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PUM1

Pumilio-1 encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3' untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Long Name

Pumilio 1

Alternate Names

HSPUM, PUMH1, Pumilio-1, PUML1

Gene Symbol

PUM1

Additional PUM1 Products

Product Documents for PUM1 Antibody (8Y6H5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PUM1 Antibody (8Y6H5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.