Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16455

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16455-100ul
NBP3-16455-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7V8O5

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Pyruvate Dehydrogenase E1 beta subunit Antibodies »

Product Summary for Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 260-359 of human Pyruvate Dehydrogenase E1 beta subunit (P11177). GVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5)

Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455]

Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455]

Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Western blot analysis of extracts of various cell lines, using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb (NBP3-16455) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455]

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455]

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Immunohistochemistry of paraffin-embedded mouse kidney using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb (NBP3-16455) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455]

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455]

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Immunohistochemistry of paraffin-embedded rat kidney using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb (NBP3-16455) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
View 1 more images

Applications for Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Pyruvate Dehydrogenase E1 beta subunit

The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3)

Alternate Names

DKFZp564K0164, mitochondrial, pyruvate dehydrogenase (lipoamide) beta, pyruvate dehydrogenase, E1 beta polypeptide

Gene Symbol

PDHB

Additional Pyruvate Dehydrogenase E1 beta subunit Products

Product Documents for Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.