RAB35 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79484

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79484
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all RAB35 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human RAB35. Peptide sequence: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAB35 Antibody

Western Blot: RAB35 Antibody [NBP1-79484]

Western Blot: RAB35 Antibody [NBP1-79484]

Western Blot: RAB35 Antibody [NBP1-79484] - Human heart cell lysate.
Immunocytochemistry/ Immunofluorescence: RAB35 Antibody [NBP1-79484]

Immunocytochemistry/ Immunofluorescence: RAB35 Antibody [NBP1-79484]

Immunocytochemistry/Immunofluorescence: RAB35 Antibody [NBP1-79484] - Human dorsal root ganglion neurons. Dual ICC stain RAB35 in green, NF200 in red. Note axons are out of view, this is a Z-stack section. RAB35 antibody at 1:500. Strong plasma membrane binding which is consistent with tagged construct expression. Some non-specific binding in the nucleus/nucleolus which may improve with lowered antibody concentrations. Primary incubation overnight at 4C, secondary antibodies (Alexa 488 and 546) at room temperature. ICC/IF image submitted by a verified customer review.
Western Blot: RAB35 Antibody [NBP1-79484]

Western Blot: RAB35 Antibody [NBP1-79484]

Western Blot: RAB35 Antibody [NBP1-79484] - HeLa cells, HEK293T cells. Antibody at 1:500.

Applications for RAB35 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
This RAB35 antibody is validated for ICC/IF from a verified customer review.

Reviewed Applications

Read 1 review rated 4 using NBP1-79484 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB35

Possesses GTPase activity

Alternate Names

GTP-binding protein RAY, H-ray, RAB1C, RAB35, member RAS oncogene family, Ras-related protein Rab-1C, ras-related protein rab-1c (GTP-binding protein ray), ras-related protein Rab-35, RAY

Gene Symbol

RAB35

UniProt

NP_006852 (Human)

Additional RAB35 Products

Product Documents for RAB35 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RAB35 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.