Rac1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82326

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82326-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Rac1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAC1. Peptide sequence: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Rac1 Antibody

Western Blot: Rac1 Antibody [NBP2-82326]

Western Blot: Rac1 Antibody [NBP2-82326]

Western Blot: Rac1 Antibody [NBP2-82326] - WB Suggested Anti-RAC1 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Immunohistochemistry-Paraffin: Rac1 Antibody [NBP2-82326]

Immunohistochemistry-Paraffin: Rac1 Antibody [NBP2-82326]

Immunohistochemistry-Paraffin: Rac1 Antibody [NBP2-82326] - Rabbit Anti-RAC1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Colon. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200.
Western Blot: Rac1 Antibody [NBP2-82326]

Western Blot: Rac1 Antibody [NBP2-82326]

Western Blot: Rac1 Antibody [NBP2-82326] - Sample Type: Lane 1: 20ug siRUVBL1 transfected human H1299 cells Lane 2: 20ug untransfected human H1299 cells Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:3000 Color/Signal Descriptions: RAC1 Gene

Applications for Rac1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rac1

Plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization and growth-factor induced formation of membrane ruffles.

Long Name

Ras-related C3 Botulinum Toxin Substrate 1 (Rho Family, small GTP binding Protein Rac1)

Alternate Names

p21-Rac1, TC-25

Gene Symbol

RAC1

Additional Rac1 Products

Product Documents for Rac1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Rac1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.