Rap1A/B Antibody (6C7G0)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16868

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16868-100ul
NBP3-16868-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6C7G0

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Rap1A/B Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human Rap1A/B (P61224). LYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rap1A/B Antibody (6C7G0)

Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Western blot analysis of extracts of various cell lines, using Rap1A/B Rabbit mAb (NBP3-16868) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of U-2 OS cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of C6 cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
View 1 more images

Applications for Rap1A/B Antibody (6C7G0)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Rap1A/B

Ras-related Protein 1A (Rap1A) and Ras-related Protein 1B (Rap1B) are membrane-localized members of the Ras small GTPase superfamily of proteins. Rap1A and Rap1B are 184 amino acid (aa) propeptides that are processed into mature 181 aa proteins each with a predicted molecular mass of 21 kDa. Rap1A appears to play a vital role in the cardiovascular system where it regulates cell attachment, migration, and cell-cell junction formation. Rap1A counteracts the mitogenic functions of Ras and several reports suggest that it mediates the progression of multiple cancers where it may regulate metastasis. Rap1B has also been shown to participate in the organization of the vascular lumen by regulating endothelial cell polarity. It also plays a significant role in platelet function, where it mediates adhesion signaling.

Long Name

Ras-related Protein 1A/B

Alternate Names

RAP1A, RAP1B

Gene Symbol

RAP1A

Additional Rap1A/B Products

Product Documents for Rap1A/B Antibody (6C7G0)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Rap1A/B Antibody (6C7G0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.