RAPGEF2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88124

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88124
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RAPGEF2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of mouse RAPGEF2. Peptide sequence: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAPGEF2 Antibody

Western Blot: RAPGEF2 Antibody [NBP2-88124]

Western Blot: RAPGEF2 Antibody [NBP2-88124]

Western Blot: RAPGEF2 Antibody [NBP2-88124] - Host: Rabbit. Target Name: Rapgef2. Sample Type: Mouse Brain lysates. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124]

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124]

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124] - Rabbit Anti-RAPGEF2 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Small Intestine. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200.
Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124]

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124]

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124] - Rabbit Anti-RAPGEF2 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adrenal. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.

Applications for RAPGEF2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAPGEF2

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF2, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM]

Alternate Names

CNrasGEF, KIAA0313, Neural RAP guanine nucleotide exchange protein, nRap GEP, NRAPGEP, PDZ domain containing guanine nucleotide exchange factor (GEF) 1, PDZGEF1, PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1, RA(Ras/Rap1A-associating)-GEF, RA-GEFDKFZP586O1422, Rap guanine nucleotide exchange factor (GEF) 2, rap guanine nucleotide exchange factor 2, Rap-GEP

Gene Symbol

RAPGEF2

Additional RAPGEF2 Products

Product Documents for RAPGEF2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RAPGEF2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.