RAPGEF2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88125

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88125
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RAPGEF2 Antibodies »

Product Summary for RAPGEF2 Antibody

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse RAPGEF2. Peptide sequence: SILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAPGEF2 Antibody

Western Blot: RAPGEF2 Antibody [NBP2-88125]

Western Blot: RAPGEF2 Antibody [NBP2-88125]

Western Blot: RAPGEF2 Antibody [NBP2-88125] - WB Suggested Anti-Rapgef2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Kidney
Western Blot: RAPGEF2 Antibody [NBP2-88125]

Western Blot: RAPGEF2 Antibody [NBP2-88125]

Western Blot: RAPGEF2 Antibody [NBP2-88125] - Human sperm and mouse liver

Applications for RAPGEF2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAPGEF2

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF2, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM]

Alternate Names

CNrasGEF, KIAA0313, Neural RAP guanine nucleotide exchange protein, nRap GEP, NRAPGEP, PDZ domain containing guanine nucleotide exchange factor (GEF) 1, PDZGEF1, PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1, RA(Ras/Rap1A-associating)-GEF, RA-GEFDKFZP586O1422, Rap guanine nucleotide exchange factor (GEF) 2, rap guanine nucleotide exchange factor 2, Rap-GEP

Gene Symbol

RAPGEF2

Additional RAPGEF2 Products

Product Documents for RAPGEF2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RAPGEF2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.