RASGRF1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85603

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85603-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RASGRF1 Antibodies »

Product Summary for RASGRF1 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RASGRF1. Peptide sequence: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RASGRF1 Antibody

Western Blot: RASGRF1 Antibody [NBP2-85603]

Western Blot: RASGRF1 Antibody [NBP2-85603]

Western Blot: RASGRF1 Antibody [NBP2-85603] - Host: Rabbit. Target Name: RASGRF1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Western Blot: RASGRF1 Antibody [NBP2-85603]

Western Blot: RASGRF1 Antibody [NBP2-85603]

Western Blot: RASGRF1 Antibody [NBP2-85603] - WB Suggested Anti-RASGRF1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain
Western Blot: RASGRF1 Antibody [NBP2-85603]

Western Blot: RASGRF1 Antibody [NBP2-85603]

Western Blot: RASGRF1 Antibody [NBP2-85603] - Host: Rabbit. Target Name: RASGRF1. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml

Applications for RASGRF1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RASGRF1

RASGRF1 is a critical step in signal transduction responses to stimulation of cell surface receptors by their ligands involves the accumulation of Ras proteins in their active GTP-bound state. To reach their active GTP-bound state, Ras proteins must first release bound GDP, a rate limiting step mediated by a guanine nucleotide releasing factor (GRF). The mammalian Ras p21 GRF protein has been designated Ras-GRF1 p140. Ras-GRF1 accelerates release of GDP from H- and N-Ras p21 protein in vitro, but not from the related Ral A or Cdc42Hs GTP-binding proteins. Of interest, a region mapping within the amino terminal domain of Ras-GRF1 is similar to both the human breakpoint cluster protein, Bcr, and the Dbl proto-oncogene product, a guanine nucleotide-releasing factor for Cdc42Hs. Ras-GRF2 p135 has also been identified. Ras-GRF2 p135 is highly homologous to Ras-GRF1 p140 except in the region between the REM and CDC25 domains and appears to function similarly to Ras-GRF1 p140.

Alternate Names

CDC25guanine nucleotide exchange factor, CDC25L, GNRPguanine nucleotide-releasing factor 1, GRF1, GRF55, guanine nucleotide-releasing factor, 55 kD, Guanine nucleotide-releasing protein, H-GRF55, PP13187, Ras protein-specific guanine nucleotide-releasing factor 1, Ras-GRF1, ras-specific guanine nucleotide-releasing factor 1, Ras-specific guanine nucleotide-releasing factor, CDC25 homolog, Ras-specific nucleotide exchange factor CDC25

Gene Symbol

RASGRF1

Additional RASGRF1 Products

Product Documents for RASGRF1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RASGRF1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.