RbAp46 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86767

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86767
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RbAp46 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RbAp46. Peptide sequence: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RbAp46 Antibody

Western Blot: RbAp46 Antibody [NBP2-86767]

Western Blot: RbAp46 Antibody [NBP2-86767]

Western Blot: RbAp46 Antibody [NBP2-86767] - WB Suggested Anti-RBBP7 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate

Applications for RbAp46 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RbAp46

RBBP7 antibody, also known as RbAp46 (Retinoblastoma protein associated protein 46), is a nuclear protein that has been shown to interact directly with retinoblastoma protein and is a component of the mSin3 corepressor complex, as are the histone deacetylase proteins (HDACs). It shares about 75% sequence identity with the closely related RbAp48, and appears to be functionally related to the yeast MSI1 protein in that overexpression of RbAp46 suppresses heat shock sensitivity in a RAS pathway dependent manner. RBBP7 has also been demonstrated to be up-regulated by the Wilms' tumor suppressor gene product, WT1. In addition, cells transfected with this antibody have shown strong inhibition of growth.

Alternate Names

G1/S transition control protein-binding protein RbAp46, Histone acetyltransferase type B subunit 2, histone-binding protein RBBP7, MGC138867, Nucleosome-remodeling factor subunit RBAP46, RBAP46, RBBP-7, retinoblastoma binding protein 7, Retinoblastoma-binding protein 7MGC138868, Retinoblastoma-binding protein p46, retinoblastoma-binding protein RbAp46

Gene Symbol

RBBP7

Additional RbAp46 Products

Product Documents for RbAp46 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RbAp46 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.