RHCE Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69668

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69668
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all RHCE Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RHCE(Rh blood group, CcEe antigens) The peptide sequence was selected from the N terminal of RHCE. Peptide sequence SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RHCE Antibody

Western Blot: RHCE Antibody [NBP1-69668]

Western Blot: RHCE Antibody [NBP1-69668]

Western Blot: RHCE Antibody [NBP1-69668] - This Anti-RHCE antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Applications for RHCE Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RHCE

The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease.The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease. Alternative splicing of this gene results in four transcript variants encoding four different isoforms.

Alternate Names

blood group Rh(CE) polypeptide, blood group RhCcEe antigen, CD240CE, CD240CE antigen, MGC103977, RH, Rh blood group antigen Evans, Rh blood group C antigen, Rh blood group, CcEe antigens, Rh polypeptide 1, Rh polypeptide I, Rh30A, Rh4, RHC, RHCE blood group variant Crawford antigen Rh43, RHE, Rhesus blood group CE protein, Rhesus blood group E antigen, Rhesus blood group Rhce antigen, Rhesus blood group, CcEe antigens, Rhesus C/E antigens, Rhesus system C and E polypeptides, RhIVb(J), RhIXB, RHPI, RhVI, RhVIII, silenced Rh blood group CcEe antigen

Gene Symbol

RHCE

Additional RHCE Products

Product Documents for RHCE Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RHCE Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.