RhoC Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-58351

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-58351
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Invertebrate

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all RhoC Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RHOC (ras homolog gene family, member C). The peptide sequence was selected from the N terminal of RHOC. Peptide sequence: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Brugia malayi testing from a customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RhoC Antibody

Western Blot: RhoC Antibody [NBP1-58351]

Western Blot: RhoC Antibody [NBP1-58351]

Western Blot: RhoC Antibody [NBP1-58351] - Lanes: Lane 1 : 20 ug of Brugia malayi total worm extract Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 5000 Gene name: RHOC Submitted by: Peter U. Fischer, Washington University School of Medicine.
Immunohistochemistry: RhoC Antibody [NBP1-58351]

Immunohistochemistry: RhoC Antibody [NBP1-58351]

Immunohistochemistry: RhoC Antibody [NBP1-58351] - Brugia malayi intestinal cross section Primary Antibody Dilution: 1 : 200 Secondary Antibody: Anti-rabbit-AP Secondary Antibody Dilution: 1 : 5000 Gene name: RHOC Submitted by: Peter U. Fischer, Ph. D. , Research Associate Professor, Washington University School of Medicine, Infectious Disease Division, Campus Mailbox 8051, 660 S. Euclid Ave, St. Louis, MO 63110 USA, Tel 314-454-7876 Fax 314-454-5293.
Western Blot: RhoC Antibody [NBP1-58351]

Western Blot: RhoC Antibody [NBP1-58351]

Western Blot: RhoC Antibody [NBP1-58351] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Applications for RhoC Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RhoC

RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Alternate Names

ARH9ARHCRho cDNA clone 9, h9, MGC1448, MGC61427, oncogene RHO H9, ras homolog gene family, member C, RAS-related homolog 9, RhoC, rhoC GTPase, RHOH9, rho-related GTP-binding protein RhoC, small GTP binding protein RhoC

Gene Symbol

RHOC

UniProt

P08134 (Human)

Additional RhoC Products

Product Documents for RhoC Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RhoC Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.