RHOT2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88153

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88153
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RHOT2 Antibodies »

Product Summary for RHOT2 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHOT2. Peptide sequence: TIPADVTPEKVPTHIVDYSEAEQTDEELREEIHKANVVCVVYDVSEEATI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RHOT2 Antibody

Western Blot: RHOT2 Antibody [NBP2-88153]

Western Blot: RHOT2 Antibody [NBP2-88153]

Western Blot: RHOT2 Antibody [NBP2-88153] - WB Suggested Anti-RHOT2 Antibody. Positive Control: Lane 1: 20ug untransfected HEK293T Lane 2: 20ug RHOT2 transfected HEK293T. Primary Antibody Dilution : 1:1000. Secondary Antibody : Anti-rabbit-HRP. Secondry Antibody Dilution : 1:2000. Submitted by: Jin

Applications for RHOT2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RHOT2

RHOT2 is a gene that codes for a protein that is 618 amino acids long and weighs approximately 68 kDa and has a shorter isoform that is 213 amino acids long and weighs approximately 23 kDa. The protein that RHOT2 codes for is a mitochondrial GTPase that is involved in mitochondrial trafficking as well as the control of the subcellular distribution of mitochondria. Current research is being done on diseases and disorders linked to this gene including hypoxia. RHOT2 has been shown to have interactions with ZFYVE9, RYK, TRAK1, BECN1, and CLN3 in pathways such as the Rho GTPase cycle and signal transduction pathways.

Alternate Names

ARHT2, C16orf39, chromosome 16 open reading frame 39, EC 3.6.5, EC 3.6.5.-, hMiro-2, MIRO-2mitochondrial Rho 2, mitochondrial Rho GTPase 2, Ras homolog gene family member T2, ras homolog gene family, member T2, RASL

Gene Symbol

RHOT2

Additional RHOT2 Products

Product Documents for RHOT2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RHOT2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.