RNF141 Antibody (6D9)

Novus Biologicals, part of Bio-Techne | Catalog # H00050862-M01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00050862-M01
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 6D9

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all RNF141 Antibodies »

Product Specifications

Immunogen

RNF141 (NP_001008563, 141 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHR

Reactivity Notes

Human, Mouse, & Rat. Other species not tested.

Specificity

RNF141 - ring finger protein 141

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for RNF141 Antibody (6D9)

Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9 Analysis of RNF141 expression in A-431.
Immunohistochemistry-Paraffin: RNF141 Antibody (6D9) [H00050862-M01]

Immunohistochemistry-Paraffin: RNF141 Antibody (6D9) [H00050862-M01]

Immunohistochemistry-Paraffin: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of monoclonal antibody to RNF141 on formalin-fixed paraffin-embedded human testis. Antibody concentration 0.3 ug/ml.
Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of RNF141 over-expressed 293 cell line, cotransfected with RNF141 Validated Chimera RNAi ( Cat # H00050862-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF141 monoclonal antibody (M01), clone 6D9 (Cat # H00050862-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
View 4 more images

Applications for RNF141 Antibody (6D9)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation, and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RNF141

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis.

Alternate Names

C3HC4-like zinc finger protein, MGC8715, ring finger protein 141, Zinc finger protein 230, ZNF230ZFP26

Entrez Gene IDs

50862 (Human)

Gene Symbol

RNF141

UniProt

NP_057506.2 (Human)

Additional RNF141 Products

Product Documents for RNF141 Antibody (6D9)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RNF141 Antibody (6D9)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.