Skip to main content

ROR alpha/NR1F1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-52813

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-52813

Key Product Details

Species Reactivity

Validated:

Human, Rat

Cited:

Human, Mouse

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

Product Specifications

Immunogen

Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ROR alpha/NR1F1 Antibody

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - Western blot analysis of RORa expression in NP tissues isolated from three rats showed positive expression of the protein. Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.8521) licensed under a CC-BY license.
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - HepG2 cell lysate, concentration 1.25ug/ml.
ROR alpha/NR1F1 Antibody

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] -

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - BMAL1 controls HIF-1 activity without affecting HIF-alpha -TAD functionA. Evaluation of BMAL1 & ROR alpha expression by Western blot in NP cells stably transduced with lentivirus expressing BMAL1 shRNA. B., C. Densitometric analysis of multiple blots shown in (A) demonstrated decreased BMAL1 (B) & ROR alpha (C) expression in BMAL1-silenced cells under both normoxia & hypoxia. D. HRE activity of BMAL1-silenced NP cells is significantly lower than cells transduced with control shRNA. E.-G. Evaluation of BMAL1 control of HIF-alpha -TAD function. BMAL1 overexpression had no effects on HIF-1 alpha-C-TAD (E), HIF-1 alpha-N-TAD (F), as well as HIF-2 alpha-TAD (G) regardless of oxygen tension. Data is represented as mean ± SE, n= 3, * p<0.05. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27049729), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ROR alpha/NR1F1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1.0 ug/ml
Application Notes
Use in Immunofluorescence (PMID: 21480365), IHC-P reported in scientific literature (PMID:35803929).

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ROR alpha/NR1F1

The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.

Long Name

Retinoic Acid-Related Orphan Receptor alpha

Alternate Names

NR1F1, RORA, RZRA

Entrez Gene IDs

6095 (Human)

Gene Symbol

RORA

UniProt

Additional ROR alpha/NR1F1 Products

Product Documents for ROR alpha/NR1F1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ROR alpha/NR1F1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...