RPL5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57126

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-57126
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, A. thaliana

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all RPL5 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RPL5(ribosomal protein L5) The peptide sequence was selected from the N terminal of RPL5 (NP_000960). Peptide sequence RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RPL5 Antibody

Western Blot: RPL5 Antibody [NBP1-57126]

Western Blot: RPL5 Antibody [NBP1-57126]

Western Blot: RPL5 Antibody [NBP1-57126] - Sample Type: Arabidopsis thaliana extract (30ug) Primary Diltution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:15,000 Exposure Time: 1 minute Image Submitted By: Anonymous.
Western Blot: RPL5 Antibody [NBP1-57126]

Western Blot: RPL5 Antibody [NBP1-57126]

Western Blot: RPL5 Antibody [NBP1-57126] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Applications for RPL5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL5

RPL5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18P family of ribosomal proteins. It is located in the cytoplasm. The protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The protein interacts specifically with the beta subunit of casein kinase II. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

DBA6,60S ribosomal protein L5, MGC117339, ribosomal protein L5

Entrez Gene IDs

6125 (Human)

Gene Symbol

RPL5

UniProt

P46777 (Human)

Additional RPL5 Products

Product Documents for RPL5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RPL5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.