RRAS Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09347

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09347-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RRAS Antibodies »

Product Summary for RRAS Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat RRAS (NP_001101951). Peptide sequence ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RRAS Antibody

Western Blot: RRAS Antibody [NBP3-09347]

Western Blot: RRAS Antibody [NBP3-09347]

Western Blot: RRAS Antibody [NBP3-09347] - Western blot analysis of RRAS in Rat Stomach lysates. Antibody dilution at 1.0ug/ml

Applications for RRAS Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RRAS

R-Ras is a member of the Ras superfamily of GTPases. Ras proteins function as signaling focal points that are activated by convergent signaling pathways intiated by extracellular stimuli (reviewed in Mitin et al, 2005). Activated Ras proteins in turn regulate a diversity of downstream cytoplasmic signaling cascades. Many members of the Ras superfamily are implicated in the regulation of hematopoietic cells, with roles in growth, survival, differentiation, cytokine production, chemotaxis, vesicle-trafficking, and phagocytosis. The Ras superfamily of proteins includes over 150 small GTPases (distinguished from the large, heterotrimeric GTPases, the G-proteins). It comprises six subfamilies, the Ras, Rho, Ran, Rab, Arf, and Kir/Rem/Rad subfamilies. They exhibit considerable overall amino acid identities, especially in the regions interacting with the guanine nucleotide exchange factors that catalyze their activation. Recognizes R-Ras; human R-Ras is a 218 amino acid protein.

Alternate Names

Oncogene RRAS, p23, ras-related protein R-Ras, related RAS viral (r-ras) oncogene homolog

Gene Symbol

RRAS

Additional RRAS Products

Product Documents for RRAS Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RRAS Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.