RTVP-1/GLIPR1 Antibody (8D9)

Novus Biologicals, part of Bio-Techne | Catalog # H00011010-M04

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00011010-M04
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 8D9

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all RTVP-1 Antibodies »

Product Specifications

Immunogen

GLIPR1 (NP_006842, 23 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for RTVP-1/GLIPR1 Antibody (8D9)

Western Blot: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04]

Western Blot: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04]

Western Blot: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04] - Analysis of GLIPR1 expression in HeLa(Cat # L013V1).
Sandwich ELISA: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04] - Detection limit for recombinant GST tagged GLIPR1 is 0.03 ng/ml as a capture antibody.

Applications for RTVP-1/GLIPR1 Antibody (8D9)

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RTVP-1

The protein encoded by the GLIPR1 gene works as a proapoptic initiator in prostate and bladder cells. Not all variants of the GLIPR1 gene have been documented even though multiple isoforms have been described (isoform 1: 255 AA long, 30 kDA; isoform 2: 237 AA long, nearly 30 kDA). The glioma pathogenesis-related protein 1 provided by the GLIPR1 gene is related to both the pathogenesis-related protein (PR) superfamily as well as the cysteine-rich secretory protein (CRISP) family. GLIPR1 has been research regarding its role in Wilms tumors, neuronitis, prostatitis, leukemia, glioblastoma, astrocytoma where increased expression has been linked with myelomocytic differentiation in macrophage and decreased expression (through gene methylation) has been associated to prostate cancer. The GLIPR1 gene interacts with genes CHD9, NCOA2, NCOA6, CREBBP, and CARM1 to participate in metabolism, expression of GLIPR1 and PPARA activation gene expression.

Long Name

Related to Testis-specific Vespid and Pathogenesis Protein 1

Alternate Names

GLIPR1, RTVP1

Gene Symbol

GLIPR1

UniProt

NP_006842 (Human)

Additional RTVP-1 Products

Product Documents for RTVP-1/GLIPR1 Antibody (8D9)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RTVP-1/GLIPR1 Antibody (8D9)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.