SCAMP5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13284

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-13284
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all SCAMP5 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SCAMP5 Antibody

Western Blot: SCAMP5 Antibody [NBP2-13284]

Western Blot: SCAMP5 Antibody [NBP2-13284]

Western Blot: SCAMP5 Antibody [NBP2-13284] - Analysis in control (vector only transfected HEK293T lysate) and SCAMP5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284]

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284]

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284]

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284]

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human cerebral cortex shows high expression.
View 5 more images

Applications for SCAMP5 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCAMP5

Secretory Carrier Membrane Proteins (SCAMPs) are proteins that are components of post Golgi membranes. These proteins are implicated to function in membrane trafficking. In fibroblasts, SCAMPs are concentrated in compartments that are involved in the recycling of cell surface receptors and endocytosis. In neurons, SCAMPs are associated with synaptic vesicles, secretion granules and transporter vesicles. SCAMPs are composed of four central transmembrane regions and a cytoplasmic tail. Of the five known SCAMPs, SCAMPs 1-3 contain cytoplasmic N-terminal regions with NPF repeats. NPF repeats are found to interact with EH domain proteins that function in budding of transport vesicles from the plasma membrane or the Golgi complex. SCAMPs 4 and 5 lack the N-terminal NPF repeats. SCAMPs 1-4 are all ubiquitously coexpressed while SCAMP 5 is only detectable in the brain. Studies show that SCAMP 5 is expressed late in development which is coincident with expansion of mature synapses.

Alternate Names

DKFZp686L1799, hSCAMP5, MGC24969, Sc5, secretory carrier membrane protein 5, secretory carrier-associated membrane protein 5

Gene Symbol

SCAMP5

Additional SCAMP5 Products

Product Documents for SCAMP5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SCAMP5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.