SEC61A Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86797

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86797
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all SEC61A Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC61A. Peptide sequence: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC The peptide sequence for this immunogen was taken from within the described region.

Specificity

This antibody made against SEC61A1 but the immunogen shows 98% sequence identity with human SEC61A2. Reactivity with SEC61A2 has not been determined experimentally.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SEC61A Antibody

Western Blot: SEC61A Antibody [NBP2-86797]

Western Blot: SEC61A Antibody [NBP2-86797]

Western Blot: SEC61A Antibody [NBP2-86797] - Host: Rabbit. Target Name: SEC61A1. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: SEC61A Antibody [NBP2-86797]

Western Blot: SEC61A Antibody [NBP2-86797]

Western Blot: SEC61A Antibody [NBP2-86797] - WB Suggested Anti-SEC61A1 Antibody. Titration: 1.0 ug/ml. Positive Control: HT1080 Whole CellSEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080
Western Blot: SEC61A Antibody [NBP2-86797]

Western Blot: SEC61A Antibody [NBP2-86797]

Western Blot: SEC61A Antibody [NBP2-86797] - Host: Rabbit. Target Name: SEC61A1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Applications for SEC61A Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC61A

SEC61A belongs to the SECY/SEC61 alpha family. It has similarity to a mouse protein which suggests a role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum.The SEC61 complex is responsible for translocation of proteins across the rough endoplasmic reticulum membrane. SEC61 is composed of three subunits: alpha, beta, and gamma; that associate to form a heterotrimer. Multiple heterotrimers associate forming the ER translocon. SEC61 alpha is a polytopic protein that has ten membrane-spanning loops. SEC61 has been found to be tightly associated with membrane bound ribosomes, either directly or through adaptor proteins, and is required for assembly of membrane and secretory proteins.

Alternate Names

HSEC61, protein transport protein SEC61 alpha subunit, protein transport protein Sec61 subunit alpha, protein transport protein Sec61 subunit alpha isoform 1, SEC61, Sec61 alpha 1 subunit (S. cerevisiae), Sec61 alpha-1, sec61 homolog, SEC61A

Gene Symbol

SEC61A1

Additional SEC61A Products

Product Documents for SEC61A Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SEC61A Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.