Semenogelin I Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-58013

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-58013
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all Semenogelin I Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SEMG1(semenogelin I) The peptide sequence was selected from the N terminal of SEMG1 (NP_002998). Peptide sequence QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Semenogelin I Antibody

Western Blot: Semenogelin I Antibody [NBP1-58013]

Western Blot: Semenogelin I Antibody [NBP1-58013]

Western Blot: Semenogelin I Antibody [NBP1-58013] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Semenogelin I Antibody [NBP1-58013]

Immunohistochemistry: Semenogelin I Antibody [NBP1-58013]

Immunohistochemistry: Semenogelin I Antibody [NBP1-58013] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: Semenogelin I Antibody [NBP1-58013]

Western Blot: Semenogelin I Antibody [NBP1-58013]

Western Blot: Semenogelin I Antibody [NBP1-58013] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
View 1 more images

Applications for Semenogelin I Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Semenogelin I

SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

CT103, dJ172H20.2, FLJ78262, semen coagulating protein, semenogelin IMGC14719, semenogelin-1, SEMGcancer/testis antigen 103, SGI

Entrez Gene IDs

6406 (Human)

Gene Symbol

SEMG1

UniProt

P04279 (Human)

Additional Semenogelin I Products

Product Documents for Semenogelin I Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Semenogelin I Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.