Serpin C1/Antithrombin-III Antibody (2X2V4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15363

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15363-100ul
NBP3-15363-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2X2V4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Serpin C1/Antithrombin-III Antibodies »

Product Summary for Serpin C1/Antithrombin-III Antibody (2X2V4)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Serpin C1/Antithrombin-III (P01008). MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLAD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Serpin C1/Antithrombin-III Antibody (2X2V4)

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363] - Western blot analysis of extracts of various cell lines, using Serpin C1/Antithrombin-III Rabbit mAb (NBP3-15363) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Immunohistochemistry-Paraffin: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Immunohistochemistry-Paraffin: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363] - Immunohistochemistry of paraffin-embedded human liver using Serpin C1/Antithrombin-III Rabbit mAb (NBP3-15363) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363] - Western blot analysis of extracts of various cell lines, using Serpin C1/Antithrombin-III Rabbit mAb (NBP3-15363) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for Serpin C1/Antithrombin-III Antibody (2X2V4)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Serpin C1/Antithrombin-III

Antithrombin III (ATH III) is a plasma protein synthesised in the liver. Normal plasma levels are 115 to 160mg/L. ATH III consists of a single polypeptide chain and has a molecular weight of 58kDa. ATH III is a serine protease inhibitor and regulates coagulation by the formation of covalently liked complexes. ATH III also has a heparin binding site and in the presence of heparin the inhibition of thrombin, factors IXa, Xa and XIa is enhanced 1000 fold. Low levels of ATH III (functional or concentration) are associated with deep vein thrombosis and pulmonary embolism. Antithrombin assays are based on immunologic, enzymatic, or clotting properties

Alternate Names

Antithrombin-III, ATIII

Gene Symbol

SERPINC1

Additional Serpin C1/Antithrombin-III Products

Product Documents for Serpin C1/Antithrombin-III Antibody (2X2V4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Serpin C1/Antithrombin-III Antibody (2X2V4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.