SLC7A2 Antibody

Validated:

Cited:

Validated:

Cited:

Unconjugated

Polyclonal Rabbit IgG

0.5 mg/ml

Synthetic peptides corresponding to SLC7A2(solute carrier family 7 (cationic amino acid transporter, y+ system), member 2) The peptide sequence was selected from the middle region of SLC7A2 (NP_001008539). Peptide sequence VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC The peptide sequence for this immunogen was taken from within the described region.

Equine reactivity reported in scientific literature (PMID: 29903343).

Polyclonal

Rabbit

IgG

72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Affinity purified

PBS, 2% Sucrose

0.09% Sodium Azide

0.5 mg/ml

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.