Smad5 Antibody (2D7)

Novus Biologicals, part of Bio-Techne | Catalog # H00004090-M01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00004090-M01
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2D7

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Smad5 Antibodies »

Product Specifications

Immunogen

SMAD5 (AAH09682, 105 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN

Specificity

SMAD5 - SMAD, mothers against DPP homolog 5 (Drosophila)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Smad5 Antibody (2D7)

Western Blot: Smad5 Antibody (2D7) [H00004090-M01]

Western Blot: Smad5 Antibody (2D7) [H00004090-M01]

Western Blot: Smad5 Antibody (2D7) [H00004090-M01] - SMAD5 monoclonal antibody (M01), clone 2D7. Analysis of SMAD5 expression in K-562.
Immunocytochemistry/ Immunofluorescence: Smad5 Antibody (2D7) [H00004090-M01]

Immunocytochemistry/ Immunofluorescence: Smad5 Antibody (2D7) [H00004090-M01]

Immunocytochemistry/Immunofluorescence: Smad5 Antibody (2D7) [H00004090-M01] - Analysis of monoclonal antibody to SMAD5 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Smad5 Antibody (2D7) [H00004090-M01]

Western Blot: Smad5 Antibody (2D7) [H00004090-M01]

Western Blot: Smad5 Antibody (2D7) [H00004090-M01] - SMAD5 monoclonal antibody (M01), clone 2D7 Analysis of SMAD5 expression in Hela S3 NE.
View 2 more images

Applications for Smad5 Antibody (2D7)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Smad5

SMADs are members of the MAD-related family of molecules. MAD-related proteins are a family of intracellular proteins that are essential components in the signaling pathways of the serine/threonine kinase receptors of the transforming growth factor beta superfamily (1). SMADs can be divided into receptor-regulated SMADs (R-SMADs: SMAD1, SMAD2, SMAD5, SMAD8 and SMAD9), common-mediator SMAD (co-SMAD: SMAD4), and inhibitory SMADs (I-SMADs: SMAD6 and SMAD7). SMAD1, SMAD5, SMAD8 and SMAD9 have high degrees of homology and antibodies are available that recognize sequences common to all of them. SMAD8 and SMAD9 are typically used as alternate names for one another in the literature. Human SMAD1 is a 465 amino acid protein; GenBank Accession No. AAP36050.1. Human SMAD2 is a 467 amino acid protein; GenBank Accession No. AAC51918.1 Human SMAD3 is a 425 amino acid protein; GenBank Accession No. NP_005893.1 Human SMAD4 is a 552 amino acid protein GenBank Accession No. NP_005350.1. Human SMAD5 is a 465 amino acid protein; GenBank Accession No. AAC50791.1. Human SMAD6 is a 496 amino acid protein; GenBank Accession No. AAH12986.1 Human SMAD7 is a 426 amino acid protein; GenBank Accession No. AAB81354.1 Mouse SMAD8 is a 430 amino acid protein; GenBank Accession No. AAN85445.1 Human SMAD9 is a 430 amino acid protein; GenBank Accession No. NP_005896.1.

Long Name

Mothers Against DPP Homolog 5

Alternate Names

Dwfc, JV5-1, MADH5

Entrez Gene IDs

4090 (Human)

Gene Symbol

SMAD5

OMIM

603110 (Human)

UniProt

AAH09682 (Human)

Additional Smad5 Products

Product Documents for Smad5 Antibody (2D7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Smad5 Antibody (2D7)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.