SMOC-1 Antibody (8F10)

Novus Biologicals, part of Bio-Techne | Catalog # H00064093-M03

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00064093-M03
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Zebrafish

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 8F10

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all SMOC-1 Antibodies »

Product Specifications

Immunogen

SMOC1 (NP_071420, 150 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS

Reactivity Notes

Human. Other species not tested.

Specificity

SMOC1 - SPARC related modular calcium binding 1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for SMOC-1 Antibody (8F10)

Western Blot: SMOC-1 Antibody (8F10) [H00064093-M03]

Western Blot: SMOC-1 Antibody (8F10) [H00064093-M03]

Western Blot: SMOC-1 Antibody (8F10) [H00064093-M03] - Analysis of SMOC1 expression in A-431 (Cat # L015V1).
Immunocytochemistry/ Immunofluorescence: SMOC-1 Antibody (8F10) [H00064093-M03]

Immunocytochemistry/ Immunofluorescence: SMOC-1 Antibody (8F10) [H00064093-M03]

Immunocytochemistry/Immunofluorescence: SMOC-1 Antibody (8F10) [H00064093-M03] - Analysis of monoclonal antibody to SMOC1 on A-431 cell. Antibody concentration 10 ug/ml
Western Blot: SMOC-1 Antibody (8F10) [H00064093-M03]

Western Blot: SMOC-1 Antibody (8F10) [H00064093-M03]

Western Blot: SMOC-1 Antibody (8F10) [H00064093-M03] - Analysis of SMOC1 expression in transfected 293T cell line by SMOC1 monoclonal antibody (M03), clone 8F10. Lane 1: SMOC1 transfected lysatE (48.3 KDa). Lane 2: Non-transfected lysate.
View 1 more images

Applications for SMOC-1 Antibody (8F10)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SMOC-1

SMOC-1 (secreted, or SPARC-related, modular calcium-binding protein 1) is a 70-90 kDa secreted glycoprotein that is a member of the SPARC family of matricellular molecules. Mature mouse SMOC-1 is 427 amino acids (aa) in length. It contains one Kazal-like domain (aa 42-86), two thyroglobulin type-1 segments (aa 91-157 and 223-291) and two functional EF-hand sequences (aa 358-393 and 395-430). Two splice variants contain an insertion of eleven aa after Lys174, with one of these also including an alternate start site at Met65. Mature mouse SMOC-1 shares 99% aa identity with rat SMOC-1 and 92% aa identity with human, canine and bovine SMOC-1. The principal difference between rodents and other mammals is an additional 19 aa near the C-terminus of rodent SMOC-1. Like other matricellular proteins, SMOC-1 is primarily expressed in basement membranes, although it has also been found in other extracellular matrices and the oocyte zona pellucida. It is present early in mouse embryogenesis, and is produced by cells deriving from all three germ layers. Recombinant bacterially produced human SMOC-1 and SMOC-2 were both shown to bind the acute phase protein, C-reactive protein, and the adhesion proteins, fibulin and vitronectin. A signaling role for SMOC-1 was shown in rat mesangial cells: induction of nitric oxide in response to inflammatory cytokines downregulates SMOC-1 which, in turn, downregulates expression of TGF-beta and TGF-beta-regulated genes. This mechanism is proposed to limit the profibrotic effects of TGF-beta, for example in the glomerulus. In Xenopus, the SMOC paralog has been shown to antagonize BMP activity.

Long Name

Secreted Modular Calcium-binding Protein 1

Alternate Names

SMOC1, SPARC-related modular calcium-binding protein 1

Entrez Gene IDs

64093 (Human)

Gene Symbol

SMOC1

OMIM

608488 (Human)

UniProt

NP_071420 (Human)

Additional SMOC-1 Products

Product Documents for SMOC-1 Antibody (8F10)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SMOC-1 Antibody (8F10)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.