SNRPN Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82347

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82347-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all SNRPN Antibodies »

Product Summary for SNRPN Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SNRPN. Peptide sequence: TASIAGAPTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SNRPN Antibody

Western Blot: SNRPN Antibody [NBP2-82347]

Western Blot: SNRPN Antibody [NBP2-82347]

Western Blot: SNRPN Antibody [NBP2-82347] - Host: Rabbit. Target Name: SNRPN. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for SNRPN Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNRPN

The protein encoded by this gene is one polypeptide of a small nuclear ribonucleoprotein complex and belongs to the snRNP SMB/SMN family. The protein plays a role in pre-mRNA processing, possibly tissue-specific alternative splicing events. Although individual snRNPs are believed to recognize specific nucleic acid sequences through RNA-RNA base pairing, the specific role of this family member is unknown. The protein arises from a bicistronic transcript that also encodes a protein identified as the SNRPN upstream reading frame (SNURF). Multiple transcription initiation sites have been identified and extensive alternative splicing occurs in the 5' untranslated region. Additional splice variants have been described but sequences for the complete transcripts have not been determined. The 5' UTR of this gene has been identified as an imprinting center. Alternative splicing or deletion caused by a translocation event in this paternally-expressed region is responsible for Angelman syndrome or Prader-Willi syndrome due to parental imprint switch failure.

Alternate Names

DKFZp686C0927, DKFZp686M12165, DKFZp761I1912, DKFZp762N022, FLJ39265, HCERN3FLJ33569, MGC29886, Prader-Willi syndrome chromosome region, PWCR, RT-LI, Sm protein D, Sm protein N, small nuclear ribonucleoprotein polypeptide N, small nuclear ribonucleoprotein-associated protein N, Sm-D, SmN, Sm-N, SMNFLJ36996, SNRNP-N, SNURF-SNRPN, tissue-specific splicing protein, Tissue-specific-splicing protein

Gene Symbol

SNRPN

Additional SNRPN Products

Product Documents for SNRPN Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SNRPN Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.