Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-95255

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-95255-0.02ml
NBP2-95255-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Sodium Potassium ATPase Alpha 1 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Sodium Potassium ATPase Alpha 1 (NP_000692.2). MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free

Western Blot: Sodium Potassium ATPase Alpha 1 AntibodyAzide and BSA Free [NBP2-95255]

Western Blot: Sodium Potassium ATPase Alpha 1 AntibodyAzide and BSA Free [NBP2-95255]

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-95255] - Western blot analysis of extracts of various cell lines, using Sodium Potassium ATPase Alpha 1 antibody (NBP2-95255) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-95255] - Immunohistochemistry of paraffin-embedded mouse kidney using Sodium Potassium ATPase Alpha 1 Rabbit pAb (NBP2-95255) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-95255] - Immunohistochemistry of paraffin-embedded human liver cancer using Sodium Potassium ATPase Alpha 1 Rabbit pAb (NBP2-95255) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
View 1 more images

Applications for Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sodium Potassium ATPase Alpha 1

Sodium Potassium ATPase is an integral membrane protein complex that hydrolyzes ATP to maintain the transmembrane gradients of Na+ and K+ found in most mammalian cells. The Sodium Potassium ATPase enzyme is comprised of an alpha and beta subunit. The alpha-polypeptide (Sodium Potassium ATPase Alpha 1) has been shown to be the catalytically active subunit, whereas the Beta-polypeptide appears to be necessary for the assembly and transport of the sodium pump to the plasma membrane. Sodium Potassium ATPase alpha-1 subunit, in the brain, is expressed in both neuronal and non-neuronal cells.

Long Name

Sodium/potassium-transporting ATPase subunit alpha-1

Alternate Names

ATP1A1, EC 7.2.2.13

Gene Symbol

ATP1A1

Additional Sodium Potassium ATPase Alpha 1 Products

Product Documents for Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.