Skip to main content

Spectrin alpha 1 Antibody [Alexa Fluor® 594]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-36712AF594

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Alexa Fluor 594 (Excitation = 590 nm, Emission = 617 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 940-1160 of human Spectrin alpha 1 (NP_003117.2).

Sequence:
KHEAFLLDLNSFGDSMKALRNQANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAADHQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKVADDLLFEGLLTPEGAQIRQE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for Spectrin alpha 1 Antibody [Alexa Fluor® 594]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Spectrin alpha 1

Spectrin is a major constituent of the erythrocyte skeleton accounting for 25% of the total membrane protein and 75% of the cytoskeletal mass. It is associated with the cytoplasmic surface of the membrane by attachment to ankyrin, a peripheral membrane protein. The membrane skeleton influences several cellular properties such as cell shape, restriction of mobility of the integral membrane protein exposed at the cell surface and transmembrane movement of phospholipids and cholesterol. On SDS PAGE gels erythrocyte spectrin appears as two bands referred to as alpha (240 kDa) and beta (220 kDa). While the simplest form of spectrin in solution is an alpha-beta heterodimer, spectrin can undergo self-association in various conditions to form a tetramer of alpha2-beta2. In recent years a large number of spectrin-like molecules have been found in non-erythroid cells. These proteins are known by such different names as fodrin, CBP I, calspectin and TW 260/240.

Alternate Names

alpha-I spectrin, EL2, erythrocyte, HS3, spectrin, alpha, erythrocytic 1 (elliptocytosis 2)

Gene Symbol

SPTA1

Additional Spectrin alpha 1 Products

Product Documents for Spectrin alpha 1 Antibody [Alexa Fluor® 594]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Spectrin alpha 1 Antibody [Alexa Fluor® 594]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...
×