SPSB2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-74266

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-74266
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Monkey

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all SPSB2 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the C terminal of SPSB2. Immunizing peptide sequence IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SPSB2 Antibody

Western Blot: SPSB2 Antibody [NBP1-74266]

Western Blot: SPSB2 Antibody [NBP1-74266]

Western Blot: SPSB2 Antibody [NBP1-74266] - COLO205 Cell Lysate 1ug/ml Gel Concentration 12%
Immunohistochemistry: SPSB2 Antibody [NBP1-74266]

Immunohistochemistry: SPSB2 Antibody [NBP1-74266]

Immunohistochemistry: SPSB2 Antibody [NBP1-74266] - Rhesus macaque spinal cord Primary Antibody Dilution: 1 : 300 Secondary Antibody: Donkey anti Rabbit 488 Secondary Antibody Dilution: 1 : 500Color/Signal Descriptions: Green: SPSB2 Gene name: SPSB2 Submitted by: Timur Mavlyutov, Ph. D. , Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706.

Applications for SPSB2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPSB2

This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes.

Alternate Names

FLJ17395, Gene-rich cluster protein C9, GRCC9MGC2519, splA/ryanodine receptor domain and SOCS box containing 2, SPRY domain-containing SOCS box protein SSB-2, SSB-2, SSB2SPRY domain-containing SOCS box protein 2

Gene Symbol

SPSB2

UniProt

Q99619 (Human)

Additional SPSB2 Products

Product Documents for SPSB2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SPSB2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.