Sterol carrier protein 2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-55214

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-55214
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Sterol carrier protein 2 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SCP2(sterol carrier protein 2) The peptide sequence was selected from the middle region of SCP2 (NP_001007099). Peptide sequence NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Sterol carrier protein 2 Antibody

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for Sterol carrier protein 2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sterol carrier protein 2

SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.

Alternate Names

DKFZp686C12188, DKFZp686D11188, NLTP, non-specific lipid-transfer protein, NSL-TP, Propanoyl-CoA C-acyltransferase, SCP-2, SCP-CHI, SCPX, SCP-X, sterol carrier protein 2EC 2.3.1.176, Sterol carrier protein X

Entrez Gene IDs

6342 (Human)

Gene Symbol

SCP2

UniProt

Q6NXF4 (Human)

Additional Sterol carrier protein 2 Products

Product Documents for Sterol carrier protein 2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Sterol carrier protein 2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.