TATA binding protein TBP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38610

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38610
NBP2-38610-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all TATA binding protein TBP Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TATA binding protein TBP Antibody

Immunocytochemistry/ Immunofluorescence: TATA binding protein TBP Antibody [NBP2-38610]

Immunocytochemistry/ Immunofluorescence: TATA binding protein TBP Antibody [NBP2-38610]

Immunocytochemistry/Immunofluorescence: TATA binding protein TBP Antibody [NBP2-38610] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry: TATA binding protein TBP Antibody [NBP2-38610]

Immunohistochemistry: TATA binding protein TBP Antibody [NBP2-38610]

Immunohistochemistry: TATA binding protein TBP Antibody [NBP2-38610] - Staining of human testis shows weak nuclear positivity in cells in seminiferous ducts and Leydig cells.

Applications for TATA binding protein TBP Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TATA binding protein TBP

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein TBP and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease.TPB is also known to interact with HIV1 Tat protein.

Alternate Names

GTF2D, GTF2D1, HDL4, MGC126054, MGC126055, SCA17, TATA box binding protein, TATA sequence-binding protein, TATA-binding factor, TATA-box binding protein N-terminal domain, TATA-box factor, TATA-box-binding protein, TF2D, TFIIDMGC117320, Transcription initiation factor TFIID TBP subunit

Gene Symbol

TBP

UniProt

P20226 (Human)

Additional TATA binding protein TBP Products

Product Documents for TATA binding protein TBP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TATA binding protein TBP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.