TFIP11 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86861

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86861
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all TFIP11 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TFIP11. Peptide sequence: QKELSQWRKDPSGSKKKPKYSYKTVEELKAKGRISKKLTAPQKELSQVKV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TFIP11 Antibody

Western Blot: TFIP11 Antibody [NBP2-86861]

Western Blot: TFIP11 Antibody [NBP2-86861]

Western Blot: TFIP11 Antibody [NBP2-86861] - Host: Rabbit. Target Name: TFP11. Sample Type: Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for TFIP11 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TFIP11

Neurotensin (NT) initiates an intracellular response by interacting with the G protein-coupled receptors NTR1 (NTS1 receptor, high affinity NTR) and NTR2 (NTS2 receptor, levocabastine-sensitive neurotensin receptor), and the type I receptor NTR3 (NTS3 receptor, sortilin-1, Gp95). NT has a wide distribution in regions of the brain and in peripheral tissues where NT receptors can contribute to hypotension, hyperglycemia, hypothermia, antinociception and regulation of intestinal motility and secretion. HL-60 cells express NTR1, which can couple to Gq, Gi/o, or Gs. Alternative splicing of rat NTR2 can generate a 5-transmembrane domain variant isoform that is co-expressed with the full-length NTR2 throughout the brain and spinal cord. NTR3 activation in the murine microglial cell line N11 induces MIP-2, MCP-1, IL-1beta and TNFalpha in an ERK1/2 and Akt kinase-dependent manner.

Alternate Names

bK445C9.6, DKFZP434B194, FLJ22086, hNtr1, NTR1, Septin and tuftelin-interacting protein 1, STIP, STIP-1, TIP39Spp382, tuftelin interacting protein 11, tuftelin-interacting protein 11

Gene Symbol

TFIP11

Additional TFIP11 Products

Product Documents for TFIP11 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TFIP11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.