TGF-beta 1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-80289

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-80289-20ul
NBP1-80289
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Porcine

Cited:

Mouse, Rat, Porcine

Applications

Validated:

Imaging Mass Cytometry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

IF/IHC, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, In vivo assay, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all TGF-beta 1 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Porcine reactivity reported in scientific literature (PMID: 23616520).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TGF-beta 1 Antibody

Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Immunocytochemistry/ Immunofluorescence: TGF-beta 1 Antibody [NBP1-80289]

Immunocytochemistry/ Immunofluorescence: TGF-beta 1 Antibody [NBP1-80289]

Immunocytochemistry/Immunofluorescence: TGF-beta 1 Antibody [NBP1-80289] - Mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml
Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289]

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289]

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human Appendix FFPE tissue section stained with TGF-beta 1 antibody. IHC-P image submitted by a verified customer review.
View 7 more images

Applications for TGF-beta 1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

5-10 ug/ml

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

5-10 ug/ml

Western Blot

1.0 ug/ml
Application Notes
This TGF-beta 1 Antibody is validated for Imaging Mass Cytometry from a verified customer review.

Reviewed Applications

Read 3 reviews rated 4.7 using NBP1-80289 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TGF-beta 1

TGF-beta-1 is a multifunctional cytokine that belongs to a superfamily of structurally related regulatory proteins, which includes three mammalian TGF-beta isoforms (TGF-beta-1, -beta-2, and -beta-3), activin/inhibins and bone morphogenetic proteins. The most abundant isoform, TGF-beta-1, is a 25kDa homodimer composed of two 12.5kDa subunits joined by disulfide bonds. TGF-beta-1 is a highly conserved molecule - the amino acid sequence between human and mouse differ only by one residue. Although originally defined by its ability to cause anchorage independent cell growth and changes in cell morphology of rat fibroblasts, subsequent research has revealed that TGF-beta is actually a major growth inhibitor for most cell types. It is produced by a wide variety of cell and tissue types during all stages of cell differentiation. TGF-beta-1 sources include platelets, bone and soft tissues such as placenta and kidneys.

Long Name

Transforming Growth Factor beta 1

Alternate Names

TGF beta1, TGFB, TGFB1, TGFbeta 1

Gene Symbol

TGFB1

UniProt

NP_035707 (Mouse)

Additional TGF-beta 1 Products

Product Documents for TGF-beta 1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TGF-beta 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.