TMPRSS11E Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25202

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-25202
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all TMPRSS11E Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein TMPRSS11E using the following amino acid sequence: NQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TMPRSS11E Antibody

TMPRSS11E Antibody Immunocytochemistry/Immunofluorescence: TMPRSS11E Antibody [NBP3-25202]

Immunocytochemistry/Immunofluorescence: TMPRSS11E Antibody [NBP3-25202]

Staining of human cell line HaCaT shows localization to the Golgi apparatus.

Applications for TMPRSS11E Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMPRSS11E

TMPRSS11E is a member of a larger family of membrane attached serine proteases, a poorly defined group that includes TMPRSS11A, B, C, D, E, F, Hepsin, Corin, Matriptase 1, 2 and 3. The highest degree of identity is with TMPRSS11A, which shares 43% identity at the amino acid level. TMPRSS11E has a domain structure of an aminoterminal cytoplasmic domain, followed by a transmembrane domain, a SEA domain (Sea urchin sperm protein, Enterokinase, Agrin), a short spacer, then the trypsin like serine protease domain. The SEA domain is thought to play a role in carbohydrate binding in the analogous protein sequences where it is found, but the role in TMPRSS11E is unclear. The cleavage of the Arg191 Ile192 bond liberates the catalytic domain. TMPRSS11E has been shown to cleave fibronectin, gelatin, casein and pro uPA in vitro, and to form complexes with serpinA5 and serpinE1.

Alternate Names

DESC1, FLJ75331, FLJ94490, MGC141972, MGC141974, serine 11E2, serine protease DESC1, TMPRSS11E2, transmembrane protease serine 11E, transmembrane protease serine 11E2, transmembrane protease, serine 11E, UNQ742/PRO1461

Gene Symbol

TMPRSS11E

Additional TMPRSS11E Products

Product Documents for TMPRSS11E Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TMPRSS11E Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.