TRAF7 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-04330

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-04330-100ul
NBP3-04330-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all TRAF7 Antibodies »

Product Summary for TRAF7 Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 380-479 of human TRAF7 (NP_115647.2). YDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYKCQKTLEGHDGIVLALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIRAHD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TRAF7 Antibody - Azide and BSA Free

Western Blot: TRAF7 AntibodyAzide and BSA Free [NBP3-04330]

Western Blot: TRAF7 AntibodyAzide and BSA Free [NBP3-04330]

Western Blot: TRAF7 Antibody [NBP3-04330] - Western blot analysis of extracts of various cell lines, using TRAF7 antibody (NBP3-04330) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: TRAF7 Antibody - Azide and BSA Free [NBP3-04330]

Immunocytochemistry/ Immunofluorescence: TRAF7 Antibody - Azide and BSA Free [NBP3-04330]

Immunocytochemistry/Immunofluorescence: TRAF7 Antibody [NBP3-04330] - Immunofluorescence analysis of PC-12 cells using TRAF7 antibody (NBP3-04330) at dilution of 1:50. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: TRAF7 Antibody - Azide and BSA Free [NBP3-04330]

Immunohistochemistry-Paraffin: TRAF7 Antibody - Azide and BSA Free [NBP3-04330]

Immunohistochemistry-Paraffin: TRAF7 Antibody [NBP3-04330] - Immunohistochemistry of paraffin-embedded human colon carcinoma using TRAF7 antibody (NBP3-04330) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
View 2 more images

Applications for TRAF7 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TRAF7

Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding

Alternate Names

DKFZp586I021, E3 ubiquitin-protein ligase TRAF7, EC 6.3.2.-, MGC7807, RFWD1RING finger protein 119, RNF119RING finger and WD repeat-containing protein 1, TNF receptor-associated factor 7ring finger and WD repeat domain 1

Gene Symbol

TRAF7

Additional TRAF7 Products

Product Documents for TRAF7 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TRAF7 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.