TRIM5 alpha Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35735

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-35735-100ul
NBP3-35735-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all TRIM5 alpha Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM5 alpha (NP_149083.2).

Sequence:
EKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TRIM5 alpha Antibody

TRIM5 alpha Antibody

Western Blot: TRIM5 alpha Antibody [NBP3-35735] -

Western Blot: TRIM5 alpha Antibody [NBP3-35735] - Western blot analysis of various lysates using TRIM5 alpha Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for TRIM5 alpha Antibody

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TRIM5 alpha

TRIM5-alpha is a protein that is found in the cells of many mammals and fends of various retrovirus infections. It protects monkeys from infection with HIV-1, and humans from infection with some other viruses. If a retrovirus has entered a cell, it needs to shed its capsid in order to reversely transcribe its genes, so that they can be expressed by the host cell. It is believed that TRIM5 alpha, which is present in the cytoplasm, somehow recognizes the capsid and blocks its shedding, thereby stopping the virus in its tracks. It thus represents an intracellular defense completely separate from the rest of the body's immune system.

Alternate Names

EC 6.3.2, EC 6.3.2.-, RING finger protein 88, RNF88tripartite motif protein TRIM, TRIM5alpha, tripartite motif containing 5, tripartite motif protein TRIM5, tripartite motif-containing 5, tripartite motif-containing protein 5

Gene Symbol

TRIM5

Additional TRIM5 alpha Products

Product Documents for TRIM5 alpha Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TRIM5 alpha Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.