TROP-2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49166

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-49166
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Flow Cytometry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all TROP-2 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL

Reactivity Notes

Mouse (81%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TROP-2 Antibody

Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]

Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166]

Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Analysis in human skin and liver tissues. Corresponding TROP-2 RNA-seq data are presented for the same tissues.
TROP-2 Antibody

Western Blot: TROP-2 Antibody [NBP2-49166] -

Western Blot: TROP-2 Antibody [NBP2-49166] - Analysis in human cell lines A-431 and HEK293 using Anti-TACSTD2 antibody. Corresponding TACSTD2 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/ Immunofluorescence: TROP-2 Antibody [NBP2-49166]

Immunocytochemistry/ Immunofluorescence: TROP-2 Antibody [NBP2-49166]

Immunocytochemistry/Immunofluorescence: TROP-2 Antibody [NBP2-49166] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & plasma membrane.
View 5 more images

Applications for TROP-2 Antibody

Application
Recommended Usage

Flow Cytometry

Validated for Flow Cytometry from a verified customer review.

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP2-49166 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TROP-2

TROP2 encodes a carcinoma-associated antigen defined by the monoclonal antibody GA733. This antigen is a member of a family including at least two type I membrane proteins. It transduces an intracellular calcium signal and acts as a cell surface receptor. Mutations of this gene result in gelatinous drop-like corneal dystrophy, an autosomal recessive disorder characterized by severe corneal amyloidosis leading to blindness. [provided by RefSeq]

Long Name

Tumor-associated Calcium Signal Transducer 2

Alternate Names

GA733-1, gp50, T16, TACSTD2, TROP2

Gene Symbol

TACSTD2

Additional TROP-2 Products

Product Documents for TROP-2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TROP-2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.