Troponin I type 2 (fast skeletal) Antibody (2H7S10)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16474

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16474-100ul
NBP3-16474-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2H7S10

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Troponin I type 2 (fast skeletal) Antibodies »

Product Summary for Troponin I type 2 (fast skeletal) Antibody (2H7S10)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 83-182 of human Troponin I type 2 (fast skeletal) (P48788). EVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Troponin I type 2 (fast skeletal) Antibody (2H7S10)

Western Blot: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]

Western Blot: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]

Western Blot: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474] - Western blot analysis of extracts of various cell lines, using Troponin I2 (Troponin I type 2 (fast skeletal)) Rabbit mAb (NBP3-16474) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]

Immunohistochemistry: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]

Immunohistochemistry: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474] - Immunofluorescence analysis of mouse bone marrow using Troponin I2 (Troponin I type 2 (fast skeletal)) Rabbit mAb (NBP3-16474) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Troponin I type 2 (fast skeletal) Antibody (2H7S10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Troponin I type 2 (fast skeletal)

The troponin I type 2 gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible

Alternate Names

skeletal, fast, troponin I type 2 (skeletal, fast), troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, troponin I, fast-twitch skeletal muscle isoform

Gene Symbol

TNNI2

Additional Troponin I type 2 (fast skeletal) Products

Product Documents for Troponin I type 2 (fast skeletal) Antibody (2H7S10)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Troponin I type 2 (fast skeletal) Antibody (2H7S10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.