TSLPR/CRLF2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25208

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-25208
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all TSLPR Antibodies »

Product Summary for TSLPR/CRLF2 Antibody

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein TSLPR/CRLF2 using the following amino acid sequence: YRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TSLPR/CRLF2 Antibody

TSLPR/CRLF2 Antibody Immunocytochemistry/Immunofluorescence: TSLPR/CRLF2 Antibody [NBP3-25208]

Immunocytochemistry/Immunofluorescence: TSLPR/CRLF2 Antibody [NBP3-25208]

Staining of human cell line Rh30 shows localization to plasma membrane.

Applications for TSLPR/CRLF2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSLPR

Thymic Stromal Lymphopoietin (TSLP) was originally identified as an activity from the conditioned medium of a mouse thymic stromal cell line that promoted the development of B cells. The activities of mouse TSLP overlap with, but are distinct from, those of mouse IL-7. Both mouse TSLP and IL-7 can co-stimulate growth of thymocytes and mature T cells, and support B lymphopoiesis in long-term cultures of fetal liver cells and bone-marrow cells. Whereas mouse IL-7 facilitates the development of B220+/IgM- pre-B cells, mouse TSLP promotes the development B220+/IgM+ B cells. Human TSLP was reported to preferentially stimulate myeloid cells, inducing the release of T cell-attracting chemokines from monocytes and enhancing the maturation of CD11c+ dendritic cells. Human TSLP cDNA encodes a 159 amino acid (aa) residue precursor protein with a 28 aa signal sequence. Within the mature region, six of the seven cysteine residues present in the mouse TSLP involved in intramolecular disulfide bond formation are conserved in the human TSLP. Human TSLP shares approximately 43% aa sequence identity with mouse TSLP. By Northern blot analysis, human TSLP expression has been detected in many tissues with the highest expressions in heart, liver, testis and prostate. TSLP signals through a heterodimeric receptor complex that consists of IL-7 R alpha and the TSLP R, a member of the hemopoietin receptor family most closely related to Rgammac.

TSLP R, also named Delta and CRLM-2 (Cytokine Receptor-like Module-2), was originally cloned as a novel type 1 cytokine receptor with similarity to the common gamma chain (gamma c). It was subsequently identified as a subunit of the cellular receptor for the IL-7-like cytokine TSLP and termed TSLP R. TSLP R shows 24% sequence identity with the mouse gc receptor. TSLP R expression is constitutive in immune and hematopoietic cells, but is up-regulated in Th2 cells.

Long Name

Thymic Stromal Lymphopoietin Receptor

Alternate Names

CRL2, CRLF2, CRLM-2, PCOR1, TSLP R

Gene Symbol

CRLF2

Additional TSLPR Products

Product Documents for TSLPR/CRLF2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TSLPR/CRLF2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.