Tyrosine Hydroxylase Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38903

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38903
NBP2-38903-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Tyrosine Hydroxylase Antibodies »

Product Summary for Tyrosine Hydroxylase Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Tyrosine Hydroxylase Antibody

Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903]

Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903]

Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Analysis in human adrenal gland and stomach tissues. Corresponding TH RNA-seq data are presented for the same tissues.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903]

Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903]

Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse midbrain shows positive processes and cell bodies.
Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903]

Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903]

Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
View 8 more images

Applications for Tyrosine Hydroxylase Antibody

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2), 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tyrosine Hydroxylase

The tetrameric enzyme tyrosine hydroxylase (TH), also designated as tyrosine 3-monooxygenase (TY3H), is the rate-limiting enzyme for catecholamine biosynthesis and has a theoretical molecular weight of 60 kDa. Encoded by the TH gene, TH catalyzes the conversion of the amino acid L-tyrosine to L-3,4- dihydroxyphenylalanine (L-dopa) in the central nervous system and adrenal medulla. The precursor of catecholamines, L-dopa, is converted to dopamine for use in the biosynthesis of neurotransmitters norepinephrine (noradrenaline) and epinephrine (adrenaline) (1) . Dysfunction in the TH gene, and thus the enzymatic activity by TH, dysregulates catecholamine synthesis.

Two transcription factor binding sites in the proximal region of the TH gene, the TPA-responsive element (TRE) and the c-AMP responsive element (CRE), have been implicated in the complex regulation of the TH gene. Dysregulation of breakdown for the amino acid, tyrosine, by TH is a result of a genetic disorder that results in Tyrosinemia (high levels of tyrosine in the blood, tissue and organs).

Tyrosine hydroxylase deficiency is a disorder that primarily affects movement, where individuals display symptoms that include lack of coordination when walking, postural tremors and unusual body positioning. TH deficient dopamine-responsive dystonia (DRD), also known as Segawa syndrome, is a rare genetic disorder that is associated with low levels of TH and is diagnosed during childhood with characteristic symptoms including increased muscle tone (dystonia) and signs of Parkinsonism like bradykinesia, tremors, rigidity and postural instability (2). Correspondingly, TH is also linked to Parkinson's disease in older adults, where low dopamine levels are a consistent neurochemical abnormality. Functional polymorphisms of the TH gene may be involved in the pathogenesis of neuropsychiatric diseases such as schizophrenia and other affective disorders where dopamine is often dysregulated (3).

References

1. Hamanaka, Y., & Mizunami, M. (2019). Tyrosine hydroxylase-immunoreactive neurons in the mushroom body of the field cricket, Gryllus bimaculatus. Cell Tissue Res, 376(1), 97-111. doi:10.1007/s00441-018-2969-9

2. Li, L., & Zhou, F. M. (2013). Parallel dopamine D1 receptor activity dependence of l-Dopa-induced normal movement and dyskinesia in mice. Neuroscience, 236, 66-76. doi:10.1016/j.neuroscience.2012.12.065

3. Borkar, C. D., Bharne, A. P., Nagalakshmi, B., Sakharkar, A. J., Subhedar, N. K., & Kokare, D. M. (2018). Cocaine- and Amphetamine-Regulated Transcript Peptide (CART) Alleviates MK-801-Induced Schizophrenic Dementia-Like Symptoms. Neuroscience, 375, 94-107. doi:10.1016/j.neuroscience.2018.01.056

Alternate Names

TH, TYH

Gene Symbol

TH

UniProt

P07101

Additional Tyrosine Hydroxylase Products

Product Documents for Tyrosine Hydroxylase Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Tyrosine Hydroxylase Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.