UbcH5c/UBE2D3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-55276

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-55276
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all UbcH5c/UBE2D3 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D3. Peptide sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UbcH5c/UBE2D3 Antibody

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - MCF7, Antibody Dilution: 1.0 ug/ml UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
View 4 more images

Applications for UbcH5c/UBE2D3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UbcH5c/UBE2D3

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.

Alternate Names

UBC5C, UBE2D3

Gene Symbol

UBE2D3

UniProt

P61077 (Human)

Additional UbcH5c/UBE2D3 Products

Product Documents for UbcH5c/UBE2D3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for UbcH5c/UBE2D3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.