Uroplakin IIIB Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-92564

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-92564
NBP1-92564-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Uroplakin IIIB Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Uroplakin IIIB Antibody

Immunocytochemistry/ Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564]

Immunocytochemistry/ Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564]

Immunocytochemistry/Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564] - IHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was applied for 1 hour RT, then visualized with DAB. HIER was conducted using citrate buffer pH 6.0 at 95 C for 15 minutes. Incubation of primary antibody with immunogenic peptide shows no staining in adjacent control section. Image submitted by a verified customer review.
View 3 more images

Applications for Uroplakin IIIB Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Uroplakin IIIB antibody validated for IHC from a verified customer review.

Reviewed Applications

Read 1 review rated 5 using NBP1-92564 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Uroplakin IIIB

UPK3B is a minor component of the apical plaques of mammalian urothelium that binds and dimerizes with uroplakin-1b (UPK1B; MIM 602380), one of the major conserved urothelium membrane proteins. The other major conserved integral membrane proteins of urothelial plaques are UPK1A (MIM 611557), UPK2 (MIM 611558), and UPK3A (MIM 611559) (Deng et al., 2002 [PubMed 12446744]).[supplied by OMIM]

Alternate Names

FLJ32198, MGC10902, p35, UP3b, UPIIIB, UPIIIbP35, uroplakin 3B, Uroplakin IIIb, uroplakin-3b

Gene Symbol

UPK3B

Additional Uroplakin IIIB Products

Product Documents for Uroplakin IIIB Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Uroplakin IIIB Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.